Bacterial taxon 909946
Locus STM474_3879
Protein WP_001135518.1
divergent polysaccharide deacetylase family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 320 aa, Gene yigQ, UniProt E8XG20
>WP_001135518.1|Salmonella enterica Serovar Typhimurium ST4 74|divergent polysaccharide deacetylase family protein
MPQFRRSILTLATLLAFAHPVFAGKLAIVIDDFGYRPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPADITLVRPGSLLNEPQVDTSRPGVTPQKIDAPRNPFRGVKMCKPKKPLQPVYATRFFSVIGESITQSSVVTWFQHQWQGWGKIAAPKNVSAKTD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,922,090 | -0.14 | 0.84 | ○○○○○ 0.1 | 0.10416536409197 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,922,090 | 0.29 | 0.84 | ○○○○○ 0.33 | 0.329382936692478 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,922,090 | 0.7 | 0.85 | ○○○○○ 0.54 | 0.539147850520342 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)