Bacterial taxon 909946
Locus STM474_1468
Protein WP_000361451.1
division septum protein Blr
Salmonella enterica Serovar Typhimurium ST4 74
Length 51 aa, Gene ydgT, UniProt E8XI42
>WP_000361451.1|Salmonella enterica Serovar Typhimurium ST4 74|division septum protein Blr
MDKSKQMSSIMNRLIELTGWIVLVISVILLGIANHIDNYQPPEPTASVQKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,492,930 | -1.62 | 0.0053 | ●○○○○ -0.67 | -0.666301142561629 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,492,930 | 0.45 | 0.73 | ○○○○○ 0.41 | 0.411990674931058 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,492,930 | 0.65 | 0.87 | ○○○○○ 0.51 | 0.514430566207002 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)