Bacterial taxon 909946
Locus STM474_4141
Protein WP_001196257.1
DMT family transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 299 aa, Gene yigM, UniProt E8XJF1
>WP_001196257.1|Salmonella enterica Serovar Typhimurium ST4 74|DMT family transporter
MALLIITTILWAFSFSLFGEYLAGHVDSYFAVLIRVGLAALVFLPFLRTRGHNLKTISLYMLVGAMQLGIMYMLSFHAYLYLTVSELLLFTVLTPLYITLIYDVMSQRRLRWGYAFSALLAVIGAGIIRYDRVTDHFWVGLLLVQLSNISFAIGMVGYKRLMETRPMPQHNAFAWFYLGAFLVAAVAWSLLGNAQKLPETTLQWSILVFLGVVASGIGYFMWNYGATQVDAGTLGIMNNMHVPAGLLVNLAIWHQQPHWPSFITGAAVILASLWVHRKWVAPRSAQTADDRRRDPASSE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,189,573 | -0.63 | 0.64 | ●○○○○ -0.15 | -0.149648433647162 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,189,968 | 0.53 | 0.9 | ○○○○○ 0.45 | 0.452050135367792 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,189,968 | 0.79 | 0.83 | ○○○○○ 0.59 | 0.587590554512264 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,189,824 | 0.9 | 0.77 | ○○○○○ 0.65 | 0.646610539250656 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,189,573 | 1.06 | 0.17 | ○○○○○ 0.73 | 0.726846318400222 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,189,573 | 1.27 | 0.82 | ○○○○○ 0.84 | 0.835384429504131 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,189,824 | 1.34 | 0.067 | ○○○○○ 0.87 | 0.874783279549463 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,189,824 | 2.42 | 0.091 | ○○○○○ 1.43 | 1.43308249910015 | 23637626 |
Retrieved 8 of 8 entries in 1.9 ms
(Link to these results)