Bacterial taxon 909946
Locus STM474_4592
Protein WP_000381075.1
DMT family transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 308 aa, Gene yifZ, UniProt E8XAS0
>WP_000381075.1|Salmonella enterica Serovar Typhimurium ST4 74|DMT family transporter
MDTQRQASPFARKNVVYVCAAFCCLLWGSAYPAIKSGYDLFQIATDDIPSKIVFAGYRFLFAGGLLLLFALLQRKPIGRFRPRQFAQLTLLGLTQTSLQYLFFYIGLAFTSGVKGSIMNATGTFFSVLLAHFIYQNDRLSYNKTLGCILGFAGVMVVNVSNGLDFSFNLPGEGSVVLAAFILSAATLYGKRLSQTVDPMVMTGYQLGIGGLVLVIGGYVFGGTLTIHGFSSVAILVYLTLLSSVAFALWSILLKYNRVGMIAPFNFLIPVSGAALSAIFLGENILEWKYMIALVLVCSGIWWVNKVKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,653,565 | 1.48 | 0.0077 | ○○○○○ 0.94 | 0.943648471743971 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,653,565 | -0.26 | 0.9 | ○○○○○ 0.04 | 0.0398241628871215 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,653,584 | -0.17 | 0.91 | ○○○○○ 0.09 | 0.0887881378600162 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,653,584 | 0.12 | 1 | ○○○○○ 0.24 | 0.240540074282238 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,653,405 | 0.24 | 0.97 | ○○○○○ 0.3 | 0.304071058833193 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,653,565 | 0.35 | 0.97 | ○○○○○ 0.36 | 0.359990025814181 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,653,405 | 0.81 | 0.65 | ○○○○○ 0.6 | 0.59629754717444 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,653,405 | 0.99 | 0.17 | ○○○○○ 0.69 | 0.68960257667595 | 23637626 |
Retrieved 8 of 8 entries in 1.2 ms
(Link to these results)