Bacterial taxon 909946
Locus STM474_1158
Protein WP_001217763.1
DNA damage-inducible protein I
Salmonella enterica Serovar Typhimurium ST4 74
Length 81 aa, Gene dinI, UniProt E8XET1
>WP_001217763.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA damage-inducible protein I
MRIEVTIAKTSPLPAGAIDALAGELSRRISHHFPENLGNVTVRYATANNLSVIGASKEDKERISEILQETWESADDWFINE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,204,372 | 0.55 | 0.5 | ○○○○○ 0.46 | 0.461162730484873 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,204,372 | 0.9 | 0.87 | ○○○○○ 0.64 | 0.6443093025178 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,204,372 | 2.28 | 0.076 | ○○○○○ 1.36 | 1.35973482681901 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)