Bacterial taxon 909946
Locus STM474_2146
Protein WP_000384326.1
DNA gyrase inhibitor SbmC
Salmonella enterica Serovar Typhimurium ST4 74
Length 155 aa, Gene sbmC, UniProt E8XC15
>WP_000384326.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA gyrase inhibitor SbmC
MDYEIRQEQKRKIAGFHMVGPWEHTVKQGFEQLMTWVDRQRIVPVEWIAVYYDNPDVVPAEKLRCDTVVSVAENFILPDNSEGVIVTAIEGGEYATAVARVEDRDFAKPWERFFDVLEQDSAYQIASAPCFETYLNNGMEDGYWDIEMYIPVQRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,133,526 | 1.42 | 0.074 | ○○○○○ 0.91 | 0.914671878691433 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,133,526 | 1.65 | 0.37 | ○○○○○ 1.04 | 1.03503135023849 | 23637626 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)