Bacterial taxon 909946
Locus STM474_4761
Protein WP_000203998.1
DNA polymerase III subunit psi
Salmonella enterica Serovar Typhimurium ST4 74
Length 145 aa, Gene holD, UniProt E8XCK0
>WP_000203998.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA polymerase III subunit psi
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRALTVSPDQVLPLTPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAALWQQICEHEHDFYPQHDRSPRSLAD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,833,279 | -0.68 | 0.094 | ●○○○○ -0.18 | -0.176794282354259 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,833,279 | 0.34 | 0.95 | ○○○○○ 0.36 | 0.355832862126364 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,833,279 | 5.32 | 0.17 | ○○○○○ 2.94 | 2.93891672276611 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)