Bacterial taxon 909946
Locus STM474_0856
Protein WP_000100805.1
DNA starvation/stationary phase protection protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 167 aa, Gene dps, UniProt E8XBU3
>WP_000100805.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA starvation/stationary phase protection protein
MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 896,853 | 0.29 | 0.96 | ○○○○○ 0.33 | 0.325680896272866 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 896,917 | 0.32 | 0.68 | ○○○○○ 0.34 | 0.343486779336598 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 896,853 | 0.33 | 0.95 | ○○○○○ 0.35 | 0.346031589215078 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 896,917 | 0.55 | 0.95 | ○○○○○ 0.46 | 0.464930273628368 | 23637626 |
Retrieved 4 of 4 entries in 1.4 ms
(Link to these results)