Bacterial taxon 909946
Locus STM474_3568
Protein WP_001129708.1
DNA topoisomerase
Salmonella enterica Serovar Typhimurium ST4 74
Length 180 aa, Gene yrdD, UniProt E8XDU7
>WP_001129708.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA topoisomerase
MAKSALFSVRKNEPCPQCGAELVIRSGKHGPFLGCSRYPECDYVRPLKSQADGHIVKILEGQLCPECGAVLVLRQGRFGMFIGCSQYPQCEHTVVIDKPDETAIACPACQQGHLVQRRSRYGKIFHSCDRYPECQFVINFTPVAGECPECHYPLLIEKKTAQGVKRFCASKQCGKPVPVE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,596,201 | -2.47 | 8.0e-7 | ●●○○○ -1.11 | -1.10587618821835 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,596,201 | -1.39 | 0.18 | ●○○○○ -0.54 | -0.543310121555951 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,596,201 | -0.6 | 0.82 | ●○○○○ -0.14 | -0.136934280316109 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)