Bacterial taxon 909946
Locus STM474_3678
Protein WP_000958732.1
DNA utilization protein GntX
Salmonella enterica Serovar Typhimurium ST4 74
Length 227 aa, Gene yhgH, UniProt E8XEL4
>WP_000958732.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA utilization protein GntX
MLTVPGLCWLCRMPLALSHWGICSVCARAVRQRVSLCPQCGLPAAHPSLPCGRCLQKPPPWQRLVSVSDYTPPLSLLVHQLKFTRRSEIAAALARLLLQEVLMARRSTGLQLPDRIVSVPLWSRRHWRRGFNQSDLLCQPLAHWLGCAWDSQTITRVRATATQHHLSARLRKRNLKNAFRLELPVQGLHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,690,864 | -0.04 | 0.99 | ○○○○○ 0.16 | 0.156683554990798 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,690,864 | 0.12 | 0.9 | ○○○○○ 0.24 | 0.238567952735396 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,690,864 | 0.34 | 0.82 | ○○○○○ 0.36 | 0.355876707349062 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,690,537 | 0.56 | 0.68 | ○○○○○ 0.47 | 0.466362470928722 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,690,537 | 0.7 | 0.38 | ○○○○○ 0.54 | 0.539036283541953 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,690,537 | 1.32 | 0.56 | ○○○○○ 0.86 | 0.860280535687616 | 23637626 |
Retrieved 6 of 6 entries in 1.7 ms
(Link to these results)