Bacterial taxon 909946
Locus STM474_2210
Protein WP_000494714.1
DNA-3-methyladenine glycosylase 2
Salmonella enterica Serovar Typhimurium ST4 74
Length 289 aa, Gene alkA, UniProt E8XCW3
>WP_000494714.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-3-methyladenine glycosylase 2
MFTLSWQPPYDWSWMLGFLAARAVDGVETVGEGFYARSLVVGEHRGLVSVRPHLPTHTVQVSVSAGLLPVAPACLAKVSRLFDLDCQPAQVAAVLGPLGEDRPGLRLPGSVDTFEQGVRAILGQLVSVAMAARLTAKVARRYGEALPDAPDYVCFPGPETLALADPLALKALGMPLRRAEALIHLAQATLAGKLALAAPPDIEQSVKNLQTFPGIGRWTANYFALRGWQAKDIFLPDDYLIKQRFAGMTPAQIRRYAERWKPWRSYALLHIWYTHGWQPSMDSEIAGIQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,209,244 | 0.08 | 1 | ○○○○○ 0.22 | 0.220893789696487 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,209,244 | 0.13 | 0.93 | ○○○○○ 0.24 | 0.24212269005331 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,209,244 | 0.14 | 0.87 | ○○○○○ 0.25 | 0.249233035579929 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)