Bacterial taxon 909946
Locus STM474_3814
Protein WP_001188414.1
DNA-3-methyladenine glycosylase I
Salmonella enterica Serovar Typhimurium ST4 74
Length 193 aa, Gene tag, UniProt E8XFV7
>WP_001188414.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-3-methyladenine glycosylase I
MQRCDWVSQDPLYIAYHDNEWGVPETDSRKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVRIAAMQEEDVEHLLQNTGIIRHRGKIQAIISNARAWLAMEQNGESFADFVWSFVDGQPQITQAASLDEIPTSTPASDALAKALKKRGFKFVGTTICYSFMQACGLVNDHITGCFCHPGEKHDSQIPE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,851,248 | 2.1 | 0.0078 | ○○○○○ 1.27 | 1.26739114338396 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,851,248 | -2.9 | 0.73 | ●●○○○ -1.33 | -1.32898162475245 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,851,184 | -1.1 | 0.11 | ●○○○○ -0.39 | -0.391773286330382 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,850,882 | -0.03 | 0.97 | ○○○○○ 0.16 | 0.162271328953179 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,850,882 | 0.13 | 1 | ○○○○○ 0.24 | 0.244340089136695 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,851,184 | 0.35 | 0.89 | ○○○○○ 0.36 | 0.357263496808719 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,851,248 | 0.55 | 0.75 | ○○○○○ 0.46 | 0.46467662369987 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,851,184 | 0.62 | 0.87 | ○○○○○ 0.5 | 0.500942928391001 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,850,882 | 1.34 | 0.59 | ○○○○○ 0.87 | 0.871071778773553 | 23637626 |
Retrieved 9 of 9 entries in 0.8 ms
(Link to these results)