Bacterial taxon 909946
Locus STM474_4413
Protein WP_000615248.1
DNA-binding protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 115 aa, Gene n/a, UniProt E8X8Y1
>WP_000615248.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-binding protein
MIQKSKEMVRLPEIINDLAFHASQVLIESMNIDSASAENAGQAIADRMMRNWGGQSIYFPKGISGRASERDYQIYSECDGRNYAELAKKYNLTLQWIYKIVKRVHTEKQHQRRML
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,459,460 | -0.99 | 0.17 | ●○○○○ -0.34 | -0.338154277529404 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,459,460 | 0.11 | 1 | ○○○○○ 0.23 | 0.23284663076037 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,459,460 | 0.64 | 0.59 | ○○○○○ 0.51 | 0.506875350762058 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)