Bacterial taxon 909946
Locus STM474_2935
Protein WP_001051100.1
DNA-binding protein StpA
Salmonella enterica Serovar Typhimurium ST4 74
Length 133 aa, Gene n/a, UniProt E8XK41
>WP_001051100.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-binding protein StpA
MNLMLQNLNNIRTLRAMAREFSIDVLEEMLEKFRVVTKERREEEELQQRQLAEKQEKINAFLELMKADGINPEELFAMDSAMPRSAKKRQPRPAKYRFTDFNGEEKTWTGQGRTPKPIAQALAAGKSLDDFLI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,970,056 | -5.74 | 6.7e-7 | ●●●○○ -2.8 | -2.80133615433023 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,970,056 | -2.27 | 0.014 | ●●○○○ -1 | -1.00155749988638 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,970,056 | -0.93 | 0.11 | ●○○○○ -0.31 | -0.306417724066833 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)