Bacterial taxon 909946
Locus STM474_2796
Protein WP_000972009.1
DNA-binding transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 72 aa, Gene n/a, UniProt E8XIF0
>WP_000972009.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-binding transcriptional regulator
MMHCPLCQNAAHARTSRYLSTETKERYHQCQNINCGCTFITFETLSRFIVKPGAVDPAPPHPVRNQQQQLWL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,825,752 | 0.93 | 0.22 | ○○○○○ 0.66 | 0.658631661372187 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,825,752 | 1.54 | 0.69 | ○○○○○ 0.98 | 0.97759730228882 | 23637626 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)