Bacterial taxon 909946
Locus STM474_3952
Protein WP_001274847.1
DNA-binding transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 107 aa, Gene n/a, UniProt E8XGX5
>WP_001274847.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-binding transcriptional regulator
MSAKTKFKSPAFEPIHSAASGLFSVDAIPQETMRSFDTACLSSIKDLQPLEIKALREKLNVSQPVFARYLNTSVSTVQKWESGAKRPSGMSLKLLNVVQKHGLKVLV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,000,672 | 2,71 | 0,0023 | ○○○○○ 1,58 | 1.58193218547497 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,000,672 | -1,54 | 0,12 | ●○○○○ -0,62 | -0.621907072231631 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,000,584 | 0,3 | 0,58 | ○○○○○ 0,34 | 0.335148449753808 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,000,584 | 0,58 | 0,89 | ○○○○○ 0,48 | 0.478172809955517 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,000,584 | 0,8 | 0,68 | ○○○○○ 0,59 | 0.593965332279762 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,000,672 | 1,06 | 0,69 | ○○○○○ 0,73 | 0.730081179660348 | 23637626 |
Retrieved 6 of 6 entries in 0,9 ms
(Link to these results)