Bacterial taxon 909946
Locus STM474_3975
Protein WP_001541637.1
DNA-binding transcriptional regulator DsdC
Salmonella enterica Serovar Typhimurium ST4 74
Length 307 aa, Gene dsdC, UniProt E8XHN5
>WP_001541637.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-binding transcriptional regulator DsdC
MEPLRDTRNRLLNGWQLSKLYTFEVAARHQSFALAADELSLSPSAVSHRINQLEAELGIQLFVRSHRKVELTHEGKRVFWALKSSLDTLNQEILDIKNQELSGTLTVYSRPSIAQCWLVPALGDFTRRYPSISLTMLTGNDNVNLQRAGIDLAIYFDDAPSAQLTHHFLMDEAILPVCSPDYARRFALQDNLNNLRHCTLLHDRQAWSNDSGTDEWHSWAQHFAVNLPDSSGIGFDRSDLAVIAAMNHIGVAMGRKRLVQKRLDSGELIAPFGDMRLKCHQHYYVTTLPGRQWPKIEAFIRWLQEQV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,024,163 | 0.69 | 0.35 | ○○○○○ 0.53 | 0.533178627950111 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,024,163 | 0.7 | 0.58 | ○○○○○ 0.54 | 0.543186416227743 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,024,163 | 0.76 | 0.88 | ○○○○○ 0.57 | 0.569261264006792 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,023,540 | 0.82 | 0.99 | ○○○○○ 0.6 | 0.602879592276003 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,023,366 | 0.98 | 0.94 | ○○○○○ 0.69 | 0.685684305030849 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,023,366 | 1.06 | 0.2 | ○○○○○ 0.73 | 0.725185172895456 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,023,540 | 1.58 | 0.24 | ○○○○○ 1 | 0.996712899679052 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,023,366 | 3.08 | 0.17 | ○○○○○ 1.77 | 1.77440226191319 | 23637626 |
Retrieved 8 of 8 entries in 1 ms
(Link to these results)