Bacterial taxon 909946
Locus STM474_4308
Protein WP_001025919.1
DNA-binding transcriptional regulator OxyR
Salmonella enterica Serovar Typhimurium ST4 74
Length 305 aa, Gene oxyR, UniProt E8XL80
>WP_001025919.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-binding transcriptional regulator OxyR
MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQAGLLLVDQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTIGPYLLPLIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDCAILALVKESEAFIEVPLFDEPMMLAIYEDHPWANRDRVPMSDLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLLPALAVPQERKRDGVVYLPCIKPEPRRTVGLVYRPGSPLRSRYEQLAEAIRGAMDGHFDKALKQAV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,364,894 | -6.56 | 1.4e-8 | ●●●●○ -3.23 | -3.23007968196703 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,364,894 | -4.34 | 0.00044 | ●●●○○ -2.08 | -2.07768415824087 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,365,190 | -3.63 | 0.021 | ●●○○○ -1.71 | -1.70813012070649 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,365,190 | -3.15 | 0.0044 | ●●○○○ -1.46 | -1.45941039325149 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,364,708 | -3.08 | 0.0038 | ●●○○○ -1.42 | -1.42032354645275 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,364,708 | -2.36 | 0.031 | ●●○○○ -1.05 | -1.04908448532266 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,364,894 | -0.82 | 0.28 | ●○○○○ -0.25 | -0.247659702447015 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,365,190 | -0.47 | 0.21 | ●○○○○ -0.07 | -0.0678154298840677 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,364,708 | 0.13 | 0.84 | ○○○○○ 0.25 | 0.245583349874057 | 23637626 |
Retrieved 9 of 9 entries in 2 ms
(Link to these results)