Bacterial taxon 909946
Locus STM474_1048
Protein WP_000497441.1
DNA-damage-inducible protein I
Salmonella enterica Serovar Typhimurium ST4 74
Length 63 aa, Gene msgA, UniProt E8XDL1
>WP_000497441.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-damage-inducible protein I
MFVELVYDKRNVEGLEGASEIILAELTKQVHQIFPDAEVRVKPMQANCLNSDTNKSDRENLNR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,099,979 | -4.35 | 2.1e-5 | ●●●○○ -2.08 | -2.08371811962303 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,100,007 | -3.96 | 9.2e-14 | ●●○○○ -1.88 | -1.88022067600363 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,100,007 | -3.63 | 0.00059 | ●●○○○ -1.71 | -1.70897146041101 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,099,979 | -3.47 | 3.0e-11 | ●●○○○ -1.62 | -1.62248968887127 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,099,978 | -2.67 | 0.0072 | ●●○○○ -1.21 | -1.21018439937579 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,099,978 | -1.5 | 0.42 | ●○○○○ -0.6 | -0.60077776137844 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,099,979 | -0.93 | 0.65 | ●○○○○ -0.31 | -0.308423471761266 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,100,007 | 0.22 | 0.98 | ○○○○○ 0.29 | 0.289651735091781 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,099,978 | 0.68 | 0.38 | ○○○○○ 0.53 | 0.528261063911776 | 23637626 |
Retrieved 9 of 9 entries in 0.4 ms
(Link to these results)