Bacterial taxon 909946
Locus STM474_3570
Protein WP_000124529.1
DNA-protecting protein DprA
Salmonella enterica Serovar Typhimurium ST4 74
Length 374 aa, Gene dprA, UniProt E8XDU9
>WP_000124529.1|Salmonella enterica Serovar Typhimurium ST4 74|DNA-protecting protein DprA
MARTEIWLRLMYVGDLYGEAMLNMANSLIRQPQINRTHLQEAGLTARQAERFLQLPAGVLDETLRWLELPQHHFLCADSEIYPPQLRAIDDYPGAIFIDGDPACLHTCQLAVVGSRSHSWYGERWGRLLCESLAKSGLTITSGLARGIDGVAHNAAVSMGGKSVAVLGNGLAKIYPRRHAMLAENLIATGGAVVSEFPLSTPPLPQHFPRRNRIISGLSKGVLVIEAALRSGSLVTARCALEQGRDVFALPGPIGSPGSEGTHWLIKQGATLVTTPEDILENLQYGLHWLPTTAENSLYSLNQDEAALPFPELLANVGDEVTPVDVVAERAGQPVPAVVAQLLELELAGWIAAVPGGYVRLRRASHVRRTNVFV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,597,263 | -1.48 | 0.15 | ●○○○○ -0.59 | -0.593492551159861 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,597,263 | -1.28 | 0.07 | ●○○○○ -0.49 | -0.487501934272233 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,597,630 | -0.64 | 0.37 | ●○○○○ -0.16 | -0.155304181752189 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,597,428 | 0.01 | 0.98 | ○○○○○ 0.18 | 0.180209214029627 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,597,281 | 0.35 | 0.83 | ○○○○○ 0.36 | 0.35932015188676 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,597,630 | 0.37 | 0.79 | ○○○○○ 0.37 | 0.368701702695153 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,597,428 | 0.74 | 0.2 | ○○○○○ 0.56 | 0.563169626492934 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,597,281 | 0.77 | 0.82 | ○○○○○ 0.58 | 0.577171818992603 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,597,281 | 0.85 | 0.3 | ○○○○○ 0.62 | 0.618455639188062 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,597,630 | 0.94 | 0.97 | ○○○○○ 0.66 | 0.664234965441341 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,597,263 | 1.02 | 0.92 | ○○○○○ 0.7 | 0.704514479779236 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,597,428 | 1.36 | 0.38 | ○○○○○ 0.88 | 0.883184747935519 | 23637626 |
Retrieved 12 of 12 entries in 2.1 ms
(Link to these results)