Bacterial taxon 909946
Locus STM474_3386
Protein WP_000603920.1
DoxX family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 161 aa, Gene yqjF, UniProt E8XBG0
>WP_000603920.1|Salmonella enterica Serovar Typhimurium ST4 74|DoxX family protein
MILSSDNNDAPNRVIAHENSSSRRIGPLENKMKKLEDVGVLIARILMPVLFITAGWGKISGYAGTQQYMEAMGVPGFLLPLTILLEFGGGLAILLGFLTRTTALFTAGFTLLTALIFHSNFAEGVNSLMFMKNLTIAGGFLLLALTGPGAFSLDRLLNKKW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,418,875 | 0.23 | 0.64 | ○○○○○ 0.3 | 0.298487495993897 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,418,875 | 0.64 | 0.87 | ○○○○○ 0.51 | 0.509090967038001 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,418,875 | 0.87 | 0.54 | ○○○○○ 0.63 | 0.631028924246143 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)