Bacterial taxon 909946
Locus STM474_0029
Protein WP_000291392.1
DsbA family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 281 aa, Gene bcfH, UniProt E8XG49
>WP_000291392.1|Salmonella enterica Serovar Typhimurium ST4 74|DsbA family protein
MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIVSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIAQQQAYVQLALQYRAELLSSSSPSVGPNEAKAAVVMFFDYQCSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGLAARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSGAVHDALLTNQALAQHMDFSGTPAFVVMPQTQDGDVKRVTVIPGSTTQDMLQMAIQKAKG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 31,364 | 1.55 | 0.043 | ○○○○○ 0.98 | 0.983685441179393 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 31,438 | -0.81 | 0.26 | ●○○○○ -0.25 | -0.245792097142577 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 31,945 | -0.37 | 0.8 | ●○○○○ -0.01 | -0.0129677743813319 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 31,364 | -0.09 | 0.96 | ○○○○○ 0.13 | 0.132260023646765 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 31,438 | -0.01 | 1 | ○○○○○ 0.17 | 0.169855959941944 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 31,438 | 0.19 | 0.92 | ○○○○○ 0.27 | 0.274885968709326 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 31,364 | 0.52 | 0.91 | ○○○○○ 0.45 | 0.447251744710587 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 31,945 | 1.49 | 0.82 | ○○○○○ 0.95 | 0.953265186434687 | 23637626 |
Retrieved 8 of 8 entries in 0.4 ms
(Link to these results)