Bacterial taxon 909946
Locus STM474_4602
Protein WP_000689229.1
DUF1107 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 68 aa, Gene n/a, UniProt E8XAT0
>WP_000689229.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1107 domain-containing protein
MKIFQRYNPLQVAKYVKILFRGRLYIKDVGAFEFDKGKILIPKVRDKQHLSVMSEVNRQVMRLQTEMA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,663,994 | -1.52 | 0.012 | ●○○○○ -0.61 | -0.613551483224042 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,664,038 | -0.29 | 0.93 | ○○○○○ 0.03 | 0.0271913892889589 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,664,038 | 0.4 | 0.64 | ○○○○○ 0.39 | 0.386669348659713 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,664,038 | 1.47 | 0.55 | ○○○○○ 0.94 | 0.939349945395566 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,663,994 | 2.06 | 0.34 | ○○○○○ 1.25 | 1.24638085998446 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,663,994 | 2.35 | 0.13 | ○○○○○ 1.4 | 1.39918287829908 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)