Bacterial taxon 909946
Locus STM474_4779
Protein WP_000722276.1
DUF1120 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 229 aa, Gene n/a, UniProt E8XDA7
>WP_000722276.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1120 domain-containing protein
MKKILLITAIAASFATTSVNADTTAVLKVTGQLVVGGCTPELSGGGVVDYGTIRLATLSATDVNQLGTKDVSLSISCPSATKAAWTITDDRADTHPGASVISIANGDMTNSIVSDTTMSYGVGKTTEGVKIGAFSIYTDTANVTADGVKSDAISGTVDSPVWQKSSTGIIKNGNMEMFTVATKGTTEPVPYTLAIFPLKTSLAIQNTATLAITDDTDLDGQATITLKYL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,850,302 | -4.8 | 2.1e-20 | ●●●○○ -2.31 | -2.31356907478221 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,850,387 | -4.7 | 1.5e-14 | ●●●○○ -2.26 | -2.26123384001804 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,850,302 | -2.84 | 0.0022 | ●●○○○ -1.3 | -1.29775010901194 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,850,387 | -2.65 | 0.0066 | ●●○○○ -1.2 | -1.19797897661379 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,850,587 | -2.57 | 3.5e-7 | ●●○○○ -1.16 | -1.15853895010412 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,850,643 | -2.01 | 0.0027 | ●○○○○ -0.86 | -0.864891859202325 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,850,302 | -1.84 | 0.13 | ●○○○○ -0.78 | -0.777306403662485 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,850,387 | -1.05 | 0.59 | ●○○○○ -0.37 | -0.369018489756468 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,850,643 | -0.78 | 0.74 | ●○○○○ -0.23 | -0.226362003795081 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,850,587 | -0.68 | 0.84 | ●○○○○ -0.18 | -0.175223318447614 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,850,587 | -0.62 | 0.62 | ●○○○○ -0.15 | -0.146834282745846 | 23637626 |
Retrieved 11 of 11 entries in 1 ms
(Link to these results)