Bacterial taxon 909946
Locus STM474_4780
Protein WP_000734706.1
DUF1120 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 229 aa, Gene n/a, UniProt E8XDA8
>WP_000734706.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1120 domain-containing protein
MKKLLIATSVIIGLSTSAQAVESTAVLKLTGVLTNGACIPELSDGGVVDFGTKAVSDLLPTQTNQLGYKDITLTIQCLAPAKVGWVATDNHGDSATTLTIDNATFGGQNNRIPNYQLGLGTTADGIKIGAYGLSIDANNSTADGVKTKMVASNDSNPGVWALASNEYVALTNTFPTRTTYSVGDGNGPVAFTTATFPIRVAAAIQGTDTLAITDNTTLDGQATFTLVYL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,851,563 | -0.47 | 0.52 | ●○○○○ -0.07 | -0.0656620950227838 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,851,563 | 1 | 0.93 | ○○○○○ 0.7 | 0.695784100297852 | 23637626 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)