Bacterial taxon 909946
Locus STM474_4572
Protein WP_001085592.1
DUF1190 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 212 aa, Gene yjfM, UniProt E8XAQ0
>WP_001085592.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1190 domain-containing protein
MAKKRKSRSTSGVGHSAIRRIAEPVNPFERQRNRYTPKCLTLAIMGGAAFFLLKGCGDGGNSDNDGDGTFYATVNDCIDDGNSASVCADGWNNAKTEFYANVPKQLTQERCQTQFGDCYFDITERSWVPVLSGFLLSRAIRQNRDEQYIYSSGGSSYVSRPVWRTTSGDYAWRSGTGKSDTATSPGYITRKASTVSRGGYGRSSSARGHWGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,638,371 | 0.56 | 0.37 | ○○○○○ 0.47 | 0.467225045412245 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,638,371 | 1.08 | 0.87 | ○○○○○ 0.74 | 0.737055960155939 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,638,371 | 1.14 | 0.49 | ○○○○○ 0.77 | 0.770871898582637 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)