Bacterial taxon 909946
Locus STM474_2220
Protein WP_000498586.1
DUF1266 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 238 aa, Gene n/a, UniProt E8XCX3
>WP_000498586.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1266 domain-containing protein
MFWIVLIIAALFFSWRNYKKNKPLIAARIAEEKEKDRLKDLRRDTRRRQWALALADILARRNGLPIKGVELVFKLDDDKRRYLAQQVKKELGLSENLDGAALRHKVEDILRRWPAGIGSSPRTFYHHLAAQGQVRDALAFDCMRTAFLTRCIAGLGWCDVHQAWLVLLLNAQRAQDCFDSWEDYATAYVRARRVWLTLRDTPTALAGRDLQEATHYLQDPVSRWRQLPWNEFKIFEPI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,224,783 | -1.26 | 0.47 | ●○○○○ -0.48 | -0.475472328625397 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,224,783 | -0.41 | 0.89 | ●○○○○ -0.04 | -0.0352067709548738 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,224,783 | 0.61 | 0.26 | ○○○○○ 0.49 | 0.494835682353846 | 23637626 |
Retrieved 3 of 3 entries in 2.1 ms
(Link to these results)