Bacterial taxon 909946
Locus STM474_1513
Protein WP_001066440.1
DUF1283 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 113 aa, Gene ynfB, UniProt E8XI83
>WP_001066440.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1283 family protein
MNNTLSKRLCLTAMLTLAAVVYTTSAFAETSKLVIESGDSAQSRQEAAMEKEQWNDTRSLRQKVNTRAEKEWDKADAAFDNRDKCEQSANINAYWEPNTLRCLDRRTGRVITP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,538,187 | -4.05 | 4.5e-14 | ●●○○○ -1.92 | -1.92421841001131 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,538,187 | -3.68 | 0.00039 | ●●○○○ -1.74 | -1.73621856406405 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,538,187 | -1.81 | 0.17 | ●○○○○ -0.76 | -0.763283126985086 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)