Bacterial taxon 909946
Locus STM474_4292
Protein WP_000666689.1
DUF1287 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 207 aa, Gene yijF, UniProt E8XL64
>WP_000666689.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1287 domain-containing protein
MKFAQALIGILAAFFISHISHHSPRSDTRPITVQAQTNAAIAQSAGTQIGKTLFYDAAYVRLDYPNGDLPLERGVCADVVIRALRSQQVDLQKRVHEDMQAHFSAYPNNWKLKRPDSNIDHRRVPNLETWFQRQNKALPVTDKYSDYQPGDIVSWRLDNGLAHIGVVSLNVTPEGVPLVVHNIGAGAQEEDVLFNWKVTGHFRYFSH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,343,708 | -0.83 | 0.28 | ●○○○○ -0.25 | -0.253445978230262 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,343,653 | 0.07 | 0.92 | ○○○○○ 0.21 | 0.212100884722524 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,343,653 | 0.62 | 0.67 | ○○○○○ 0.5 | 0.497480420848472 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,343,708 | 0.68 | 0.96 | ○○○○○ 0.53 | 0.53003403241709 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,343,653 | 0.83 | 0.79 | ○○○○○ 0.61 | 0.61015637661321 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,343,708 | 1.04 | 0.43 | ○○○○○ 0.72 | 0.716720958827379 | 23637626 |
Retrieved 6 of 6 entries in 1.8 ms
(Link to these results)