Bacterial taxon 909946
Locus STM474_2244
Protein WP_001197952.1
DUF1307 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 176 aa, Gene n/a, UniProt E8XCZ7
>WP_001197952.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1307 domain-containing protein
MQVLRLMALPLFALSLSVSITGCDQKNDTLQGKQNNMTAFIKKIAASKESEETQRYVGNLNGIEIKLTYYYKGDIVLRQISEHKLLYKTLKANNKEEAQKMLSQVGEAYQGMPGLTERIDYYDSYATEYVDINFTQAKISDLCKLPGSSIDNCSAYYLSMIRSQKLLEESGYHRIN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,250,816 | -1.47 | 0.0044 | ●○○○○ -0.59 | -0.588255871340492 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,250,837 | 0.4 | 0.61 | ○○○○○ 0.39 | 0.386433217294061 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,250,837 | 0.6 | 0.89 | ○○○○○ 0.49 | 0.48841135417211 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,250,816 | 0.75 | 0.83 | ○○○○○ 0.57 | 0.567808618169928 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,250,816 | 1.16 | 0.5 | ○○○○○ 0.78 | 0.781073533543964 | 23637626 |
Retrieved 5 of 5 entries in 0.8 ms
(Link to these results)