Bacterial taxon 909946
Locus STM474_4756
Protein WP_000941876.1
DUF1435 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 78 aa, Gene yjjZ, UniProt E8XCJ8
>WP_000941876.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1435 domain-containing protein
MLQRTLGSGWGVLLPGVIIVGLAFIGLSADALKLLIVSGLLLSALMLYHKQLRHFVLLPSCIALIGGMMLAMMNWNQG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,831,125 | 0.25 | 1 | ○○○○○ 0.31 | 0.307906191307124 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,831,125 | 0.57 | 0.5 | ○○○○○ 0.47 | 0.471080024017608 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,831,125 | 2.29 | 0.18 | ○○○○○ 1.37 | 1.36634637522858 | 23637626 |
Retrieved 3 of 3 entries in 1.8 ms
(Link to these results)