Bacterial taxon 909946
Locus STM474_4264
Protein WP_000802242.1
DUF1454 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 198 aa, Gene yiiQ, UniProt E8XKE9
>WP_000802242.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1454 family protein
MKPGCTLFLLLFSALTASITAHAQLSSSTTTAPYLLAGSPTFDLSISQFRENFNRQNPDLPLNEFRAIENSRDKANLTRAASKINENLYASTALERGTLKVKSMQITWLPIQGPEQKAAKAKALEYMAAIIRTVAPLLTKEQSQKKLQKMLIAGKGKHYYAETEGAVRYVVADNGEKGLTFAVEPIKLTLSENLEGAN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,313,093 | -1.75 | 0.0031 | ●○○○○ -0.73 | -0.730349407159915 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,313,093 | -0.45 | 0.88 | ●○○○○ -0.05 | -0.0545825024372273 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,313,093 | -0.37 | 0.86 | ●○○○○ -0.01 | -0.013380482619584 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)