Bacterial taxon 909946
Locus STM474_4586
Protein WP_001521305.1
DUF1471 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 91 aa, Gene yjfY, UniProt E8XAR4
>WP_001521305.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1471 domain-containing protein
MRARIMLFLAALLPGITATAAVELNNHQARNMDDVRSLGVIYINHNFATESEANLALNEEADVRNAMYYHVILIREPGSNGNIHASANIYR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,650,420 | 1.63 | 0.042 | ○○○○○ 1.02 | 1.02198625684949 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,650,420 | -1.1 | 0.57 | ●○○○○ -0.4 | -0.39520550536104 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,650,511 | 0.58 | 0.76 | ○○○○○ 0.48 | 0.479034448114595 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,650,511 | 0.65 | 0.89 | ○○○○○ 0.52 | 0.51661209622251 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,650,420 | 0.85 | 0.79 | ○○○○○ 0.62 | 0.615966817668434 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,650,511 | 0.97 | 0.3 | ○○○○○ 0.68 | 0.682366424561254 | 23637626 |
Retrieved 6 of 6 entries in 1.1 ms
(Link to these results)