Bacterial taxon 909946
Locus STM474_2609
Protein WP_001738968.1
DUF1493 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 109 aa, Gene n/a, UniProt E8XGJ7
>WP_001738968.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1493 family protein
MDVLLMRDIEKEIIDFIDQEYNTKKYFLCGPKRIITLDTSIRDDLKLVFEDSEELLQKYFKRWNVDSEGFDILNYLNPEYFGSKEPDPRKPLTVGMLVESAKAGRWLYS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,619,903 | -4.44 | 4.3e-5 | ●●●○○ -2.13 | -2.12780217360456 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,619,903 | -1.54 | 0.0045 | ●○○○○ -0.62 | -0.621663833005374 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,619,903 | -0.83 | 0.87 | ●○○○○ -0.25 | -0.253975841792632 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)