Bacterial taxon 909946
Locus STM474_3526
Protein WP_000051840.1
DUF1656 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 67 aa, Gene aaeX, UniProt E8XD69
>WP_000051840.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1656 domain-containing protein
MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFYLISRLFV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,554,387 | -1.2 | 0.26 | ●○○○○ -0.45 | -0.44549982080258 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,554,387 | -0.72 | 0.34 | ●○○○○ -0.2 | -0.196505300039474 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,554,387 | 0.07 | 1 | ○○○○○ 0.22 | 0.215435160996535 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)