Bacterial taxon 909946
Locus STM474_4512
Protein WP_001110452.1
DUF1778 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 97 aa, Gene n/a, UniProt E8X9W7
>WP_001110452.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1778 domain-containing protein
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPNAALRKTMQTPAPWEQEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,583,388 | -0.53 | 0.87 | ●○○○○ -0.1 | -0.0993096150111706 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,583,388 | 0.06 | 0.97 | ○○○○○ 0.21 | 0.209959981217065 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,583,388 | 1.15 | 0.17 | ○○○○○ 0.77 | 0.774858347422441 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)