Bacterial taxon 909946
Locus STM474_4695
Protein WP_000566905.1
DUF1788 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 200 aa, Gene n/a, UniProt E8XCD7
>WP_000566905.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1788 domain-containing protein
MIDPVLEYRLSQVQSRISEERFLKNNGSGNEIGFWIFDYPAQNELQVREHLKYLLRNLEKDHKFAHLNIFQIIVDMLTERGLFDRVCQQEVKVGTEALKKQLVGLLNQKKIADYIAKKVDLQNQEFVILTGMGNAWPLVRGHELMSALQDVMGFTPLLMFYPGTYSGHDLSPLAGIDSRNYYRAFRLVPESGPAATLNPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,771,823 | -0.56 | 0.48 | ●○○○○ -0.11 | -0.11391271488518 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,771,823 | -0.54 | 0.84 | ●○○○○ -0.1 | -0.103824299881004 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,771,586 | 0.09 | 0.9 | ○○○○○ 0.23 | 0.225216083521793 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,771,823 | 0.15 | 1 | ○○○○○ 0.26 | 0.257001776101343 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,771,586 | 0.16 | 1 | ○○○○○ 0.26 | 0.25945101233694 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,771,586 | 0.7 | 0.64 | ○○○○○ 0.54 | 0.540902405683544 | 23637626 |
Retrieved 6 of 6 entries in 1.5 ms
(Link to these results)