Bacterial taxon 909946
Locus STM474_3449
Protein WP_000051504.1
DUF1963 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 354 aa, Gene n/a, UniProt E8XCA7
>WP_000051504.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1963 domain-containing protein
MSLFFDRAGLIAELRTSNLSSAIQEKVVQQARAAIAFKRCLRDMETVKVGASRLGGLPDWPLGQSWPIRKKSVNATSRVLKLKAEKTRNARFVHEMKMSYELLNEGRKLLGQPAEDFDEEKYRLVQQRLLTEIDIRIENQLVDFPLAFVAQLNLSDLALLPGFDPLLPRRGLLSFFVDVTWEDRQPFVFWHDVEVDTLSTLAVPDDLLAFYNKIEFREPWQLCTQVECLEPLSVISVSSVCEGLSVTQQKAYESWYDALSDYEQDNPYRVDACYSGDLLGGWTIPLQRSVEDELNQNDTRWRQLFSWDEEIHSTTALLAVAGPDFGGGIDYIMMTEKDMAAQCFDRVRNVVQLD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,482,067 | -0.12 | 0.97 | ○○○○○ 0.11 | 0.112837764161856 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,481,982 | -0.11 | 0.97 | ○○○○○ 0.12 | 0.120395027784066 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,482,067 | -0.09 | 0.97 | ○○○○○ 0.13 | 0.132872191841545 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,481,982 | 0.56 | 0.71 | ○○○○○ 0.47 | 0.465608461784494 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,481,982 | 0.64 | 0.44 | ○○○○○ 0.51 | 0.51197361295463 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,482,067 | 1.09 | 0.18 | ○○○○○ 0.74 | 0.74059800905724 | 23637626 |
Retrieved 6 of 6 entries in 1.9 ms
(Link to these results)