Bacterial taxon 909946
Locus STM474_3578
Protein WP_000266515.1
DUF1992 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 122 aa, Gene yhdN, UniProt E8XDV7
>WP_000266515.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF1992 domain-containing protein
MWLLDQWAERHIIEAQRKGEFDNLPGRGEPLILDDDSHVPAELRAGYRLLKNAGCLPPELEQRRDAIQLLDILNSIREDDPRYHQVSRQLSLLELKLRQAGLSTDFLHGEYAEKLLHKINDN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,604,155 | -0.49 | 0.8 | ●○○○○ -0.08 | -0.077447513174679 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,604,155 | -0.31 | 0.92 | ○○○○○ 0.01 | 0.0137312268569763 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,604,155 | -0.02 | 0.99 | ○○○○○ 0.17 | 0.168534172586778 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)