Bacterial taxon 909946
Locus STM474_3979
Protein WP_001113454.1
DUF202 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 120 aa, Gene yidG, UniProt E8XHN9
>WP_001113454.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF202 domain-containing protein
MPDSRKARRQNDPGLQPERTSLAWFRTLLGYGALMALAVRHHWHQAGFLFWVSISVLAIVAVILWRYTLSRNLMDVAHSDFSETHVVRDKFLISLAVLSLAILFAVTHIRQLIAFIGNFI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,028,022 | -0.5 | 0.53 | ●○○○○ -0.08 | -0.0810349107148006 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,028,022 | 0.86 | 0.83 | ○○○○○ 0.62 | 0.6235065487063 | 23637626 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)