Bacterial taxon 909946
Locus STM474_3980
Protein WP_000703964.1
DUF202 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 115 aa, Gene yidH, UniProt E8XHP0
>WP_000703964.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF202 domain-containing protein
MKISRLGEAPDYRFSLANERTFLAWIRTSLGFLAAGVGLDQLAPDFATPVIRELLALLLCLFAGGLAIYGYLRWLRNEKAMRLKEDLPYTHSLLIISVILMIVAVIVMGLVLYAG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,028,068 | 0.01 | 1 | ○○○○○ 0.18 | 0.179885783262564 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,028,068 | 0.6 | 0.81 | ○○○○○ 0.49 | 0.489754877964298 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,028,068 | 1.12 | 0.18 | ○○○○○ 0.76 | 0.759326273484501 | 23637626 |
Retrieved 3 of 3 entries in 1.9 ms
(Link to these results)