Bacterial taxon 909946
Locus STM474_4562
Protein WP_001089290.1
DUF2065 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 65 aa, Gene n/a, UniProt E8XAP1
>WP_001089290.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF2065 family protein
MNSTIWLALALVLVLEGLGPMLYPGAWKKMVSALAQLPENVLRRFGGGLVVAGVVVYYMLRKTIG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,629,430 | 1.91 | 0.0092 | ○○○○○ 1.17 | 1.16720328532887 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,629,430 | 0.67 | 0.86 | ○○○○○ 0.53 | 0.52569054068413 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,629,430 | 1.79 | 0.19 | ○○○○○ 1.11 | 1.1088336752887 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)