Bacterial taxon 909946
Locus STM474_4746
Protein WP_001090314.1
DUF2501 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 153 aa, Gene yjjA, UniProt E8XCI8
>WP_001090314.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF2501 domain-containing protein
MNTAKHVLCCAAIASVLISTSGIAASQLSAQGANAQQGGMSLSALTGLLSRGAQSLSADNMNNAAGILQYCAKQKLASATNVENVKNQILNKLGLDTTQQEQDTNYLNGLQGLLKTKDGQQLNLNNIGSTPLAEKVKTKACDLVLQQGLNFLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,823,291 | -1.36 | 0.22 | ●○○○○ -0.53 | -0.527796969369238 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,823,234 | -0.19 | 0.82 | ○○○○○ 0.08 | 0.0768823560576484 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,823,234 | -0.03 | 0.99 | ○○○○○ 0.16 | 0.162582832619012 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,823,291 | 0.64 | 0.87 | ○○○○○ 0.51 | 0.508155753926996 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,823,234 | 0.97 | 0.74 | ○○○○○ 0.68 | 0.678633907118528 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,823,291 | 1.04 | 0.17 | ○○○○○ 0.72 | 0.716524218522052 | 23637626 |
Retrieved 6 of 6 entries in 1.6 ms
(Link to these results)