Bacterial taxon 909946
Locus STM474_0011
Protein WP_001258094.1
DUF2541 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 134 aa, Gene yaai, UniProt E8XG31
>WP_001258094.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF2541 family protein
MRSVLTISVGLLFGLALSSVAHANDHKILGVIAMPRNETNDLTLKIPVCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDNDNKRCVSKITFSGHTVNSSDMARLKVIGDD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 11,238 | -1.59 | 0.0026 | ●○○○○ -0.65 | -0.648453960475283 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 10,863 | -0.32 | 0.61 | ○○○○○ 0.01 | 0.0126137727076934 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 11,238 | -0.31 | 0.93 | ○○○○○ 0.02 | 0.0155138961613051 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 10,863 | 0.15 | 0.92 | ○○○○○ 0.26 | 0.256339677873261 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 10,863 | 0.24 | 0.98 | ○○○○○ 0.3 | 0.30071556076305 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 11,238 | 0.45 | 0.92 | ○○○○○ 0.41 | 0.411662310674132 | 23637626 |
Retrieved 6 of 6 entries in 1.1 ms
(Link to these results)