Bacterial taxon 909946
Locus STM474_3638
Protein WP_001521109.1
DUF2559 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 55 aa, Gene yhfg, UniProt E8XEH4
>WP_001521109.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF2559 family protein
MKKLTDKQKSRFWEQRRNVNFQQSRRLEGIEIPLVTLTADEALVRLDELRRHYER
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,642,559 | -0.44 | 0.58 | ●○○○○ -0.05 | -0.0500796491147147 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,642,559 | 0.16 | 1 | ○○○○○ 0.26 | 0.257833224418348 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,642,559 | 0.35 | 0.81 | ○○○○○ 0.36 | 0.35846466397194 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)