Bacterial taxon 909946
Locus STM474_1860
Protein WP_001537930.1
DUF2627 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 47 aa, Gene yobF, UniProt E8X8K9
>WP_001537930.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF2627 domain-containing protein
MCGIFSKEVLSKHVDVEYRFSAEPYISASSSNVSVLSMLCLRAKKTL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,893,421 | 2,63 | 0,00017 | ○○○○○ 1,54 | 1.54409137618942 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,893,408 | 0,12 | 0,89 | ○○○○○ 0,24 | 0.24048595701433 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,893,408 | 0,8 | 0,55 | ○○○○○ 0,59 | 0.590559423290885 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,893,421 | 1,34 | 0,22 | ○○○○○ 0,87 | 0.874979518196769 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,893,408 | 1,6 | 0,91 | ○○○○○ 1,01 | 1.00680075693922 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,893,421 | 2,47 | 0,094 | ○○○○○ 1,46 | 1.45895620434297 | 23637626 |
Retrieved 6 of 6 entries in 0,8 ms
(Link to these results)