Bacterial taxon 909946
Locus STM474_4543
Protein WP_000074657.1
DUF2645 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 104 aa, Gene yjeO, UniProt E8XAM5
>WP_000074657.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF2645 family protein
MSPKMFALCAIWILLAIPLIAVFSVLDKEWMIGESGITNICDVMRTVENDDSRSFGAMMTLPLFFPFFYVTVYKKIRSWFLYCVALVIFAYWSWQFFLRYQFCV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,609,486 | -0.87 | 0.72 | ●○○○○ -0.28 | -0.276219803534234 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,609,486 | -0.2 | 0.69 | ○○○○○ 0.07 | 0.0720243127569087 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,609,486 | -0.04 | 0.99 | ○○○○○ 0.16 | 0.156174015329405 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)