Bacterial taxon 909946
Locus STM474_0300
Protein WP_000968384.1
DUF2778 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 173 aa, Gene n/a, UniProt E8XIV3
>WP_000968384.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF2778 domain-containing protein
MMAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPEGNYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRGQAAGTCEIYWANWGYNRIRLESADEKTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENGEKTFTVNVKYVSGQQTNGGTKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 329,199 | -1.67 | 0.005 | ●○○○○ -0.69 | -0.689284417360131 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 329,199 | -1.13 | 0.3 | ●○○○○ -0.41 | -0.407425391038057 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 329,199 | -0.07 | 0.98 | ○○○○○ 0.14 | 0.141208863771741 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)