Bacterial taxon 909946
Locus STM474_4706
Protein WP_001654330.1
DUF302 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 153 aa, Gene n/a, UniProt E8XCE8
>WP_001654330.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF302 domain-containing protein
MSTILKPFLLAVTLMLILIRPGFATEDGAITMVKTYSAYDYLQTRARLMHAVADHGLVLFGEFDHARAAQNVNLKMPPTTVLVFGNPKGGTPLMLAHPELALDLPFRVLISQQADGRTLVSYHPAETLQRYGLDAADIQALKKLEQLVEKSLH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,780,566 | -0.44 | 0.57 | ●○○○○ -0.05 | -0.0515192965040773 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,780,566 | -0.17 | 0.96 | ○○○○○ 0.09 | 0.0896410764588643 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,780,167 | -0.12 | 0.89 | ○○○○○ 0.12 | 0.117031962779103 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,780,566 | -0.03 | 0.99 | ○○○○○ 0.16 | 0.160373937833522 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,780,167 | 0.31 | 0.96 | ○○○○○ 0.34 | 0.340418679900818 | 23637626 |
Retrieved 5 of 5 entries in 1.5 ms
(Link to these results)