Bacterial taxon 909946
Locus STM474_3819
Protein WP_000190524.1
DUF3053 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 236 aa, Gene yiaF, UniProt E8XFW2
>WP_000190524.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF3053 domain-containing protein
MATGKSCSRWFAPVVALLMVFSLSGCFDKEGDQRKAFVDFLQNTAMRSGERLPTLTADQKKQFGPFVSDYAILYGYSQQVNQAMDSGLRPVVDSVNAIRVPQDYMTQREPLRQANGSLGVLAQQLQNAKLQADAAHGALKQADDLKPVFDQVYKKVVTVPADALQPLIPAAQIFTQQLVQVGDYIAQQGEQVSFVANGIQFPTSQQASQYNALIGPLASQHQAFNQAWTAAVNATQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,856,161 | 1.04 | 0.18 | ○○○○○ 0.72 | 0.719349203367107 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,856,161 | 1.38 | 0.64 | ○○○○○ 0.89 | 0.891342069852497 | 23637626 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)